2.20 Rating by ClearWebStats
heylinkit.com is 5 years 1 month 3 weeks old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, heylinkit.com is SAFE to browse.
Get Custom Widget

Traffic Report of Heylinkit

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View heylinkit.com site advisor rating Not Applicable

Where is heylinkit.com server located?

Hosted IP Address:

198.252.106.234 View other site hosted with heylinkit.com

Hosted Country:

heylinkit.com hosted country US heylinkit.com hosted country

Location Latitude:

34.0522

Location Longitude:

-118.244

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View heylinkit.com HTML resources

Homepage Links Analysis

403: Access Forbidden

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: 1
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 198.252.106.234)

Melones Old Movies

heylinkit.com favicon - melonesoldmovies.com

Free Download Classic Old Movies

View heylinkit.com Pagerank   heylinkit.com alexa rank Not Applicable   heylinkit.com website value $ 8.95

Shop -

heylinkit.com favicon - customtshirtscheap.com

View heylinkit.com Pagerank   heylinkit.com alexa rank Not Applicable   heylinkit.com website value $ 8.95

Ebooks For Easy Life – Ebooks For Easy Life

heylinkit.com favicon - ebooksforeasylife.com

View heylinkit.com Pagerank   heylinkit.com alexa rank Not Applicable   heylinkit.com website value $ 8.95

Cinema World Movies

heylinkit.com favicon - cinemaworldmovies.com

cinemaworldmovies.com is providing you free access to all the latest movies for free. You can get every movie here for free.

View heylinkit.com Pagerank   heylinkit.com alexa rank 409,402   heylinkit.com website value $ 5,760.00

Home and Kitchen Appliances Review

heylinkit.com favicon - homeandkitchenappliancesreview.com

Ultimate Guide to Buy Home and Kitchen Appliances - Reviews and Comparison

View heylinkit.com Pagerank   heylinkit.com alexa rank Not Applicable   heylinkit.com website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 403
Status: 403 Forbidden
Content-Type: text/html; charset=UTF-8
Content-Length: 291
Content-Encoding: br
Vary: Accept-Encoding
Date: Tue, 19 Mar 2019 04:57:43 GMT
Server: LiteSpeed
Connection: close

Domain Information for heylinkit.com

Domain Registrar: WEST263 INTERNATIONAL LIMITED heylinkit.com registrar info
Registration Date: 2019-03-14 5 years 1 month 3 weeks ago
Last Modified: 2019-03-14 5 years 1 month 3 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.hawkhost.com heylinkit.com name server information 198.252.96.100 heylinkit.com server is located in United States United States
ns13.hawkhost.com heylinkit.com name server information 198.252.96.160 heylinkit.com server is located in United States United States
ns14.hawkhost.com heylinkit.com name server information 198.252.97.160 heylinkit.com server is located in United States United States
ns2.hawkhost.com heylinkit.com name server information 198.252.97.100 heylinkit.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
heylinkit.com A 14399 IP:198.252.106.234
heylinkit.com NS 21599 Target:ns13.hawkhost.com
heylinkit.com NS 21599 Target:ns14.hawkhost.com
heylinkit.com SOA 21599 MNAME:ns13.hawkhost.com
RNAME:server.hawkhost.com
Serial:2019031403
Refresh:86400
Retry:7200
Expire:2419200
heylinkit.com MX 14399 Target:heylinkit.com
heylinkit.com TXT 14399 TXT:v=spf1 +a +mx +ip4:198.252.106.85
+include:_spf.arandomserver.com ~all

Similarly Ranked Websites to Heylinkit

Google

heylinkit.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View heylinkit.com Pagerank   Alexa rank for heylinkit.com 1   website value of heylinkit.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

heylinkit.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View heylinkit.com Pagerank   Alexa rank for heylinkit.com 1   website value of heylinkit.com $ 8,833,062,960.00

Gmail

heylinkit.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View heylinkit.com Pagerank   Alexa rank for heylinkit.com 1   website value of heylinkit.com $ 8,833,062,960.00

Android Apps on Google Play

heylinkit.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View heylinkit.com Pagerank   Alexa rank for heylinkit.com 1   website value of heylinkit.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

heylinkit.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View heylinkit.com Pagerank   Alexa rank for heylinkit.com 1   website value of heylinkit.com $ 8,833,062,960.00

Full WHOIS Lookup for heylinkit.com

Domain Name: HEYLINKIT.COM
Registry Domain ID: 2369172262_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.hkdns.hk
Registrar URL: http://www.hkdns.hk
Updated Date: 2019-03-14T10:08:55Z
Creation Date: 2019-03-14T08:50:23Z
Registry Expiry Date: 2020-03-14T08:50:23Z
Registrar: West263 International Limited
Registrar IANA ID: 1915
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +86.62778877 Ext8364
Domain Status: ok https://icann.org/epp#ok
Name Server: NS1.HAWKHOST.COM
Name Server: NS13.HAWKHOST.COM
Name Server: NS14.HAWKHOST.COM
Name Server: NS2.HAWKHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-03-19T04:57:47Z